Apple - Afghanistan - English-speaking world catalog


  • 2021-12-31Collection date
  • 2022-02-15Updated
  • Website
  • Server IP:
  • Site description:Discover the innovative world of Apple and shop everything iPhone, iPad, Apple Watch, Mac, and Apple TV, plus explore accessories, entertainment, and expert device support.


about 500000~10000000



domain or bad

Fame and wealth. Prosperity and wealth Ji





window.okapiCustomTimeout=1000;if(!window.okapiForcePreview&&!window.okapiOptOut){window.okapiConfig=window.okapiConfig||[];} Apple Apple AppleStoreMaciPadiPhoneWatchVisionAirPodsTV&HomeEntertainmentAccessoriesSupport0+   iPhone15Pro Titanium.Sostrong.Solight.SoPro. Learnmore Buy   iPhone15 Newcamera.Newdesign.Newphoria. Learnmore Buy   AppleVisionPro Welcometotheeraofspatialcomputing. Learnmore Buy   AppleWatchSeries9 Smarter.Brighter.Mightier. Learnmore Buy   MacBook Pro Mind-blowing.Head-turning. Learnmore Buy   iPad Lovable.Drawable.Mical. Learnmore Buy   AirPodsPro AdaptiveAudio.Nowplaying. Learnmore Buy   AppleCard Getupto3%Daily Cashbackwitheverypurchase. Learnmore Applynow Applynow   AppleTradeIn Get$180-$620increditwhenyoutradeiniPhone 11orhigher.1 Seewhatyourdeviceisworth window.tvPlusHpData={"data":{"shelf":{"cachingPolicy":{"cache":true,"maxe":0,"type":"RefreshWithCanvas"},"displayType":"river","id":"edt.col.626ae340-a5f3-4474-8cc5-8b716ded72e5","items":[{"extendedMetadata":{"caption":"NEWEPISODESWEDNESDAYS","imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(8,35,47)p:rgb(219,218,172)s:rgb(6,207,229)t:rgb(177,181,147)q:rgb(7,173,193)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(7,60,77)p:rgb(213,218,158)s:rgb(181,205,146)t:rgb(172,186,142)q:rgb(146,176,132)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(8,23,36)p:rgb(6,205,235)s:rgb(44,201,228)t:rgb(6,169,195)q:rgb(37,166,189)"},"singleColorContentLogo":{"width":6827,"height":1058,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Realityisaconspiracy."},"genres":[{"id":"","name":"Mystery","type":"Genre","url":""}],"id":"umc.cmc.3lvo8a7ezxpysdy3gou3fsns0","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(7,60,77)p:rgb(213,218,158)s:rgb(181,205,146)t:rgb(172,186,142)q:rgb(146,176,132)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(7,66,86)p:rgb(195,209,163)s:rgb(66,203,240)t:rgb(158,180,147)q:rgb(54,176,209)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(67,88,103)p:rgb(245,246,247)s:rgb(194,221,246)t:rgb(209,214,218)q:rgb(168,194,218)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"Constellation","type":"Show","url":""},{"extendedMetadata":{"caption":"NEWEPISODESFRIDAYS","imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(57,53,48)p:rgb(249,229,198)s:rgb(236,225,203)t:rgb(211,193,168)q:rgb(200,190,172)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(171,169,159)p:rgb(14,11,10)s:rgb(23,20,18)t:rgb(46,42,40)q:rgb(52,50,46)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(29,26,29)p:rgb(208,218,216)s:rgb(150,185,203)t:rgb(172,180,178)q:rgb(126,153,168)"},"singleColorContentLogo":{"width":6227,"height":1093,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"FromStevenSpielberg,TomHanks,andGaryGoetzman."},"genres":[{"id":"","name":"Drama","type":"Genre","url":""}],"id":"umc.cmc.7bxcni0vwgll9kmicq738k5q2","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(171,169,159)p:rgb(14,11,10)s:rgb(23,20,18)t:rgb(46,42,40)q:rgb(52,50,46)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(224,208,185)p:rgb(20,15,14)s:rgb(26,26,24)t:rgb(61,54,48)q:rgb(66,62,56)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(33,31,24)p:rgb(184,210,210)s:rgb(158,199,205)t:rgb(153,174,173)q:rgb(133,166,169)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"MastersoftheAir","type":"Show","url":""},{"extendedMetadata":{"caption":"NEWEPISODESWEDNESDAYS","imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(0,11,8)p:rgb(210,184,151)s:rgb(215,150,70)t:rgb(168,150,122)q:rgb(172,122,58)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(29,24,12)p:rgb(213,163,133)s:rgb(206,153,111)t:rgb(176,136,109)q:rgb(171,127,91)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(24,26,18)p:rgb(225,162,89)s:rgb(217,144,67)t:rgb(185,134,75)q:rgb(178,120,57)"},"singleColorContentLogo":{"width":3815,"height":360,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Creationissurvival."},"genres":[{"id":"","name":"Drama","type":"Genre","url":""}],"id":"umc.cmc.6m0i5dcn60uzl206qq6ibomeh","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(29,24,12)p:rgb(213,163,133)s:rgb(206,153,111)t:rgb(176,136,109)q:rgb(171,127,91)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(24,30,35)p:rgb(247,246,237)s:rgb(196,192,186)t:rgb(203,203,196)q:rgb(161,160,156)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(4,14,19)p:rgb(212,204,185)s:rgb(202,189,151)t:rgb(170,166,152)q:rgb(162,154,124)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"TheNewLook","type":"Show","url":""},{"extendedMetadata":{"imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(78,96,118)p:rgb(242,252,253)s:rgb(215,234,244)t:rgb(209,221,226)q:rgb(188,206,218)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(24,30,45)p:rgb(248,249,250)s:rgb(182,203,228)t:rgb(203,206,209)q:rgb(150,168,192)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(19,23,36)p:rgb(193,208,227)s:rgb(153,183,212)t:rgb(158,171,189)q:rgb(126,151,177)"},"singleColorContentLogo":{"width":3271,"height":1060,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Theepicjourneytotheultimateprize."},"genres":[{"id":"","name":"Documentary","type":"Genre","url":""}],"id":"umc.cmc.6hpxli71tx1zy1mwz7tutj94h","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(24,30,45)p:rgb(248,249,250)s:rgb(182,203,228)t:rgb(203,206,209)q:rgb(150,168,192)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(33,41,59)p:rgb(174,200,222)s:rgb(146,175,205)t:rgb(146,168,189)q:rgb(123,148,175)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(30,37,50)p:rgb(204,228,240)s:rgb(173,201,221)t:rgb(169,190,202)q:rgb(144,168,187)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"Messi\u2019sWorldCup:TheRiseofaLegend","type":"Show","url":""},{"extendedMetadata":{"caption":"NEWEPISODESFRIDAYS","imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(48,70,113)p:rgb(215,233,243)s:rgb(193,213,232)t:rgb(181,200,217)q:rgb(164,184,208)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(189,203,223)p:rgb(20,24,40)s:rgb(32,40,58)t:rgb(54,60,77)q:rgb(63,73,91)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(135,154,170)p:rgb(8,11,24)s:rgb(14,24,18)t:rgb(33,39,53)q:rgb(38,50,48)"},"singleColorContentLogo":{"width":5362,"height":1706,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Thetruestorycanfinallybetold."},"genres":[{"id":"","name":"Documentary","type":"Genre","url":""}],"id":"umc.cmc.e399kebej378s053scn8nghf","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(189,203,223)p:rgb(20,24,40)s:rgb(32,40,58)t:rgb(54,60,77)q:rgb(63,73,91)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(52,73,117)p:rgb(199,215,240)s:rgb(163,194,229)t:rgb(170,187,215)q:rgb(141,170,206)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(159,179,202)p:rgb(17,23,34)s:rgb(18,26,42)t:rgb(46,54,68)q:rgb(46,57,74)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"TheDynasty:NewEnglandPatriots","type":"Show","url":""},{"extendedMetadata":{"caption":"AILABLEUNTILMARCH22","imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(16,2,2)p:rgb(226,166,133)s:rgb(241,100,71)t:rgb(184,133,107)q:rgb(196,80,57)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(60,7,13)p:rgb(225,144,110)s:rgb(236,133,100)t:rgb(192,117,91)q:rgb(201,108,83)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(35,8,6)p:rgb(231,151,111)s:rgb(231,107,90)t:rgb(192,122,90)q:rgb(192,87,73)"},"singleColorContentLogo":{"width":2221,"height":331,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"JenniferLopezperformssongsfromhernewalbumandmoreinLosAngeles."},"genres":[{"id":"","name":"Music","type":"Genre","url":""}],"id":"umc.cmc.2rxzs4ar3cbqx94kjgsm5opk9","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(60,7,13)p:rgb(225,144,110)s:rgb(236,133,100)t:rgb(192,117,91)q:rgb(201,108,83)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(85,52,78)p:rgb(206,200,234)s:rgb(226,166,152)t:rgb(182,170,203)q:rgb(198,143,137)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(12,39,96)p:rgb(116,210,247)s:rgb(83,182,238)t:rgb(95,176,217)q:rgb(68,154,209)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"AppleMusicLive:JenniferLopez","type":"Movie","url":""},{"extendedMetadata":{"imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(0,0,0)p:rgb(241,230,200)s:rgb(202,181,151)t:rgb(193,184,160)q:rgb(161,145,120)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(0,0,0)p:rgb(186,202,192)s:rgb(205,188,154)t:rgb(148,161,153)q:rgb(164,150,123)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(0,0,0)p:rgb(220,212,185)s:rgb(205,186,153)t:rgb(176,170,148)q:rgb(164,149,123)"},"singleColorContentLogo":{"width":3072,"height":826,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Youcan\u2019thidefromyourself."},"genres":[{"id":"","name":"Crime","type":"Genre","url":""}],"id":"umc.cmc.1sbjeoma6tvxgda6l0h4bb0x3","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(0,0,0)p:rgb(186,202,192)s:rgb(205,188,154)t:rgb(148,161,15Apple3)q:rgb(164,150,123)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(0,0,0)p:rgb(213,241,229)s:rgb(243,221,185)t:rgb(170,193,183)q:rgb(194,176,148)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(16,12,8)p:rgb(246,239,207)s:rgb(210,182,149)t:rgb(200,194,167)q:rgb(171,148,120)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"CriminalRecord","type":"Show","url":""},{"extendedMetadata":{"caption":"OSCAR\u00aeNOMINEE:BESTPICTURE","imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(10,13,12)p:rgb(230,231,230)s:rgb(208,209,209)t:rgb(186,187,186)q:rgb(168,170,170)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(196,196,196)p:rgb(6,6,6)s:rgb(38,39,38)t:rgb(44,44,44)q:rgb(69,70,70)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(20,24,23)p:rgb(235,236,236)s:rgb(204,207,205)t:rgb(192,194,193)q:rgb(167,170,169)"},"singleColorContentLogo":{"width":5162,"height":2226,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"10Oscar\u00aenominationsincludingBestPicture."},"genres":[{"id":"","name":"Crime","type":"Genre","url":""}],"id":"umc.cmc.5x1fg9vferlfeutzpq6rra1zf","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(196,196,196)p:rgb(6,6,6)s:rgb(38,39,38)t:rgb(44,44,44)q:rgb(69,70,70)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(151,81,47)p:rgb(252,227,180)s:rgb(252,201,139)t:rgb(232,198,154)q:rgb(232,177,121)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(100,101,101)p:rgb(213,234,223)s:rgb(254,181,121)t:rgb(191,207,199)q:rgb(223,165,117)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"KillersoftheFlowerMoon","type":"Movie","url":""},{"extendedMetadata":{"imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(186,109,48)p:rgb(14,2,0)s:rgb(32,15,5)t:rgb(49,23,10)q:rgb(63,34,14)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(200,131,67)p:rgb(24,8,2)s:rgb(35,16,10)t:rgb(59,33,15)q:rgb(68,39,22)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(180,103,47)p:rgb(4,1,0)s:rgb(5,2,0)t:rgb(39,22,9)q:rgb(40,22,9)"},"singleColorContentLogo":{"width":7884,"height":2382,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Changeisontheair."},"genres":[{"id":"","name":"Drama","type":"Genre","url":""}],"id":"umc.cmc.25tn3v8ku4b39tr6ccgb8nl6m","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(200,131,67)p:rgb(24,8,2)s:rgb(35,16,10)t:rgb(59,33,15)q:rgb(68,39,22)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(57,20,10)p:rgb(255,253,234)s:rgb(223,149,94)t:rgb(215,206,189)q:rgb(190,123,77)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(37,6,0)p:rgb(244,182,86)s:rgb(233,149,62)t:rgb(202,147,69)q:rgb(194,121,49)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"TheMorningShow","type":"Show","url":""},{"extendedMetadata":{"imes":{"channelSplashWide":{"width":4320,"height":1800,"url":"{w}x{h}sr.{f}","joeColor":"b:rgb(4,17,47)p:rgb(153,169,199)s:rgb(71,155,221)t:rgb(118,133,164)q:rgb(55,122,182)"},"posterArt":{"width":3840,"height":2160,"url":"{w}x{h}.{f}","supportsLayeredIme":true,"joeColor":"b:rgb(2,30,84)p:rgb(121,193,225)s:rgb(14,139,235)t:rgb(97,160,197)q:rgb(11,117,204)"},"channelSplashTall":{"width":1680,"height":3636,"url":"{w}x{h}tc.{f}","joeColor":"b:rgb(3,20,64)p:rgb(92,149,220)s:rgb(75,147,231)t:rgb(72,119,185)q:rgb(59,117,193)"},"singleColorContentLogo":{"width":5937,"height":892,"url":"{w}x{h}.{f}","joeColor":"b:rgb(255,255,255)p:rgb(12,12,12)s:rgb(25,25,25)t:rgb(61,61,61)q:rgb(71,71,71)"}},"longNote":"Kindnessmakesacomeback."},"genres":[{"id":"","name":"Comedy","type":"Genre","url":""}],"id":"umc.cmc.vtoh0mn0xn7t3c643xqonfzy","imes":{"shelfIme":{"height":2160,"isP3":false,"joeColor":"b:rgb(2,30,84)p:rgb(121,193,225)s:rgb(14,139,235)t:rgb(97,160,197)q:rgb(11,117,204)","supportsLayeredIme":true,"url":"{w}x{h}.{f}","width":3840},"shelfImeBackground":{"height":2160,"isP3":false,"joeColor":"b:rgb(1,27,78)p:rgb(100,194,225)s:rgb(75,148,224)t:rgb(81,161,196)q:rgb(60,124,195)","supportsLayeredIme":false,"url":"{w}x{h}.{f}","width":3840},"transitionIme":{"height":3240,"isP3":false,"joeColor":"b:rgb(2,5,41)p:rgb(165,200,235)s:rgb(108,156,216)t:rgb(132,161,196)q:rgb(87,126,181)","supportsLayeredIme":false,"url":"{w}x{h}sr.{f}","width":4320}},"isAppleOriginal":true,"releaseDate":00,"secondaryActions":["AddToUpNext"],"title":"TedLasso","type":"Show","url":""}],"metrics":{"data.uts.shelfCategoryId":"","data.uts.shelfCategoryName":"uts.category.unknown.edt.col.626ae340-a5f3-4474-8cc5-8b716ded72e5","data.uts.responseId":"e28fe83e-67eb-4c19-9bea-52ca172bc63e","data.uts.displayType":"River"},"url":""}},"utsk":"6e3013c6d6fae3c2::::::c069bb0efb","marcom":{"timestamp_utc":"2024-02-27T13:24:11.145Z","locale":"en-US","storefront":"","collection_id":"edt.col.626ae340-a5f3-4474-8cc5-8b716ded72e5","url":""}} AppleTV+ AppleFooter 1.Trade-invalueswillvarybasedonthecondition,year,andconfigurationofyoureligibletrade-indevice.Notalldevicesareeligibleforcredit.Youmustbeatleast18yearsoldtobeeligibletotradeinforcreditorforanApple Gift Card.Trade-invaluemaybeappliedtowardqualifyingnewdevicepurchase,oraddedtoanApple Gift Card.Actualvalueawardedisbasedonreceiptofaqualifyingdevicematchingthedescriptionprovidedwhenestimatewasmade.Salestaxmaybeassessedonfullvalueofanewdevicepurchase.In-storetrade-inrequirespresentationofavalidphotoID(locallawmayrequiresingthisinformation).Offermaynotbeailableinallstores,andmayvarybetweenin-storeandonlinetrade-in.Somestoresmayheadditionalrequirements.Appleoritstrade-inpartnersreservetherighttorefuseorlimitquantityofanytrade-intransactionforanyreason.MoredetailsareailablefromApple’strade-inpartnerfortrade-inandrecyclingofeligibledevices.Restrictionsandlimitationsmayapply.,intheApple Storeapp,andatApple Stores. ToaccessanduseallApple CardfeaturesandproductsailableonlytoApple Cardusers,youmustaddApple CardtoWalletonaniPhoneoriPadthatsupportsandhasthelatestversionofiOSoriPadOS.Apple Cardissubjecttocreditapproval,ailableonlyforqualifyingapplicantsintheUnitedStates,andissuedbyGoldmanSachsBankUSA,SaltLakeCityBranch. IfyouresideintheU.S.territories,pleasecallGoldmanSachsatwithquestionsaboutApple Card. LearnmoreabouthowApple AsubscriptionisrequiredforApple TV+. MajorLeueBaseballtrademarksandsareusedwithpermissionofMLBAdvancedMedia,L.P.Allrightsreserved. ShopandLearn ShopandLearn Store Mac iPad iPhone Watch Vision AirPods TV&Home AirT Accessories GiftCards AppleWallet AppleWallet Wallet Apple Card Apple Pay Apple Cash Account Account ManeYourApple ID AppleStoreAccount Entertainment Entertainment Apple One Apple TV+ Apple Music Apple Arcade Apple Fitness+ Apple News+ ApplePodcasts Apple Books App Store AppleStore AppleStore FindaStore GeniusBar TodayatApple AppleCamp AppleStoreApp CertifiedRefurbished Apple Trade In Financing CarrierDealsatApple OrderStatus ShoppingHelp ForBusiness ForBusiness AppleandBusiness ShopforBusiness ForEducation ForEducation AppleandEducation ShopforK-12 ShopforCollege ForHealthcare ForHealthcare AppleinHealthcare HealthonApple Watch HealthRecordsoniPhone ForGovernment ForGovernment ShopforGovernment ShopforVeteransandMilitary AppleValues AppleValues Accessibility Education Environment InclusionandDiversity Apple Privacy RacialEquityandJustice SupplierResponsibility AboutApple AboutApple Newsroom AppleLeadership CareerOpportunities Investors Ethics&Compliance Events ContactApple Morewaystoshop:FindanAppleStoreorotherretailernearyou.Orcall1-800-MY-APPLE. UnitedStates © 2024 AppleInc.Allrightsreserved. PrivacyPolicy TermsofUse SalesandRefunds Legal SiteMap { "@context":"", "@id":"/#organization", "@type":"Organization", "name":"Apple", "url":"/", "logo":"/ac/structured-data/imes/knowledge_graph_logo.png?0743", "subOrganization":{ "@type":"Organization", "name":"AppleSupport", "url":"", "@id":"" }, "contactPoint":[ { "@type":"ContactPoint", "telephone":"+1-", "contactType":"sales", "areaServed":"US" }, { "@type":"ContactPoint", "telephone":"+1-", "contactType":"technicalsupport", "areaServed":"US", "ailableLangue":["EN","ES"] }, { "@type":"ContactPoint", "telephone":"+1-", "contactType":"customersupport", "areaServed":"US", "ailableLangue":["EN","ES"] } ], "sameAs":[ "http/entity/Q312", "/user/Apple", "/company/apple", "/Apple", "/Apple" ] } { "@context":"", "@id":"/#website", "@type":"WebSite", "url":"/", "name":"Apple", "potentialAction":{ "@type":"SearchAction", "target":"/us/search/{search_term_string}?src=mc_google", "query-input":"requiredname=search_term_string" } } { "@context":"", "@id":"/#webpe", "@type":"WebPe", "url":"/", "name":"Apple" }


If there is a violation of the site, please click ReportReport

Recommended information